(data stored in ACNUC7421 zone)

EMBL: CP000031.PE81

CP000031.PE81        Location/Qualifiers
FT   CDS             complement(79789..80397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM48708.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93412"
FT                   /db_xref="GOA:Q5LWN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN0"
FT                   /protein_id="AAV93412.1"
FT                   /translation="MAIDSYSRVVQYLKVLLPLTALGLLSAVFLLSSRGTDSVAPIPFA
FT                   EDEIADRTRGQQITGPFFTAVTPKGEQIQVQATLARPGGENAPAEATDLIAELLLLGGK
FT                   RIRLTSDLGTVQLDKDLAIFTGNVVITTSDGLTVTTDQLNAGLSGISGETPGNVRGTGP
FT                   IGEFTAGSMQMGAENEDGPIHIRFKNGVKLLYDPKAAER"
     MAIDSYSRVV QYLKVLLPLT ALGLLSAVFL LSSRGTDSVA PIPFAEDEIA DRTRGQQITG        60
     PFFTAVTPKG EQIQVQATLA RPGGENAPAE ATDLIAELLL LGGKRIRLTS DLGTVQLDKD       120
     LAIFTGNVVI TTSDGLTVTT DQLNAGLSGI SGETPGNVRG TGPIGEFTAG SMQMGAENED       180
     GPIHIRFKNG VKLLYDPKAA ER                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page