(data stored in ACNUC7421 zone)

EMBL: CP000031.PE83

CP000031.PE83        Location/Qualifiers
FT   CDS             complement(81366..81980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0083"
FT                   /product="exonuclease, putative"
FT                   /note="identified by match to protein family HMM PF01612"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93413"
FT                   /db_xref="GOA:Q5LWM8"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM8"
FT                   /protein_id="AAV93413.1"
FT                   /translation="MANHLYKNDLPDGLDLGPVVAIDCETMGLNPHRDRLCVIQMSGGD
FT                   GNTHIVQVEKGQTAAPNLCAMLENPEVLKLFHFGRFDIAALYHAFGALTAPVYCTKIAS
FT                   RLVRTYTDRHGLKNLCQELLGVDISKQQQMSDWGAETLSEAQLDYAASDVLYLHRLREA
FT                   LDGRLAREGRADLAQSCFDFLPTRARLDLVGWPETDIFAHS"
     MANHLYKNDL PDGLDLGPVV AIDCETMGLN PHRDRLCVIQ MSGGDGNTHI VQVEKGQTAA        60
     PNLCAMLENP EVLKLFHFGR FDIAALYHAF GALTAPVYCT KIASRLVRTY TDRHGLKNLC       120
     QELLGVDISK QQQMSDWGAE TLSEAQLDYA ASDVLYLHRL REALDGRLAR EGRADLAQSC       180
     FDFLPTRARL DLVGWPETDI FAHS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page