(data stored in ACNUC7421 zone)

EMBL: CP000031.PE87

CP000031.PE87        Location/Qualifiers
FT   CDS             85616..86671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93418"
FT                   /db_xref="GOA:Q5LWP2"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP2"
FT                   /protein_id="AAV93418.1"
FT                   /translation="MPAKLLIQESSIMTYRHFAALTGAAALFAGAVQAQEAPGFTWEGS
FT                   LELEYARTFKSDTPGNEFGAATGTLELSGAYRFNDTFSVFAALTGESLNDPTPGDRNFT
FT                   DWGLYIKELGVQIETGSASFQLGKVSPSFGIAWDQTAGFFAADLAEDYELTEQLGALVA
FT                   VDLGAAGMLHAGLFYADDTALSRSAGFRRARNSTASGGAGNTGQLDNGAVTWIKSFGGT
FT                   ELRLGVRHLSRGAGDVKSENGVVASLFHSFHHMPLDLFAEVASFSGYGGTADDATYATL
FT                   NAAYALGDVTLSGTYARRDIDSTGLTELFSIGAEYEFGERYLVGAALARVEEAGATDHV
FT                   FGINFEIALGV"
     MPAKLLIQES SIMTYRHFAA LTGAAALFAG AVQAQEAPGF TWEGSLELEY ARTFKSDTPG        60
     NEFGAATGTL ELSGAYRFND TFSVFAALTG ESLNDPTPGD RNFTDWGLYI KELGVQIETG       120
     SASFQLGKVS PSFGIAWDQT AGFFAADLAE DYELTEQLGA LVAVDLGAAG MLHAGLFYAD       180
     DTALSRSAGF RRARNSTASG GAGNTGQLDN GAVTWIKSFG GTELRLGVRH LSRGAGDVKS       240
     ENGVVASLFH SFHHMPLDLF AEVASFSGYG GTADDATYAT LNAAYALGDV TLSGTYARRD       300
     IDSTGLTELF SIGAEYEFGE RYLVGAALAR VEEAGATDHV FGINFEIALG V                351
//

If you have problems or comments...

PBIL Back to PBIL home page