(data stored in ACNUC7421 zone)

EMBL: CP000031.PE88

CP000031.PE88        Location/Qualifiers
FT   CDS             86668..88158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB51963.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93419"
FT                   /db_xref="GOA:Q5LWP1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP1"
FT                   /protein_id="AAV93419.1"
FT                   /translation="MNIWGPHIVQARRAVAIFCRGLLVLMPALSLLGLTAEAEPRSADD
FT                   RQRIAAVTAPATGFTVAEPFEQLPGGAATVSGDLGRDAFSRPSANMSFERELDFHLGQA
FT                   LFDKLWVASPSSTKASDGLGPLYNARSCQACHIRDGRGQVSGGPGLVLRIGRVRGDGVL
FT                   PDPLFGLQIQDSAVPGLRPEARIAVSQAETEVTLNGGEVAVLRKPRYRLDAAEGTLHAE
FT                   STLSPRLAPQMIGLGLLEAIPEAEILARADPDDRDGDGISGRPNRVHDPETGQEALGRF
FT                   GWKAGAASVLDQTAAAFASDIGISSPLRPAPWGDCTELQVECRAALHGDGDPRGAEIDG
FT                   PALALTAFYSRNLAVPARRDVDDPDVLRGKRVFYGIGCPACHVPKHVTAQLSDQPEQSF
FT                   QLIWPYTDLLLHDMGAGLADELPQGLASGREWRTAPLWGIGLTEQVSGQARFLHDGRAR
FT                   TLLEAVLWHGGEAAAQRDRVIALAPEDRAALIRFLESL"
     MNIWGPHIVQ ARRAVAIFCR GLLVLMPALS LLGLTAEAEP RSADDRQRIA AVTAPATGFT        60
     VAEPFEQLPG GAATVSGDLG RDAFSRPSAN MSFERELDFH LGQALFDKLW VASPSSTKAS       120
     DGLGPLYNAR SCQACHIRDG RGQVSGGPGL VLRIGRVRGD GVLPDPLFGL QIQDSAVPGL       180
     RPEARIAVSQ AETEVTLNGG EVAVLRKPRY RLDAAEGTLH AESTLSPRLA PQMIGLGLLE       240
     AIPEAEILAR ADPDDRDGDG ISGRPNRVHD PETGQEALGR FGWKAGAASV LDQTAAAFAS       300
     DIGISSPLRP APWGDCTELQ VECRAALHGD GDPRGAEIDG PALALTAFYS RNLAVPARRD       360
     VDDPDVLRGK RVFYGIGCPA CHVPKHVTAQ LSDQPEQSFQ LIWPYTDLLL HDMGAGLADE       420
     LPQGLASGRE WRTAPLWGIG LTEQVSGQAR FLHDGRARTL LEAVLWHGGE AAAQRDRVIA       480
     LAPEDRAALI RFLESL                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page