(data stored in ACNUC7421 zone)

EMBL: CP000031.PE89

CP000031.PE89        Location/Qualifiers
FT   CDS             88160..89155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE32220.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93420"
FT                   /db_xref="GOA:Q5LWP0"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP0"
FT                   /protein_id="AAV93420.1"
FT                   /translation="MKQLVALILCLAAAAASADPVDQVLDVHVLPGFARLADETALLAN
FT                   AADAGCEERDPDLRAALNGALRAWAGVSHLRFGPTEAENRAFALAFWPDSRGMTPKALA
FT                   GLIAAEDPVVQEAEGFAQVSVAARGLYALEFLLYDEGQAGNDPYHCALIRAIVRDSAGL
FT                   ARAMAADWHDRYAALMRAPGPDSPYRSRDEAMQELFKALGTGLQITADLRLGRPLGSFA
FT                   RPRPNRAEAWRAGLSLLLVIEALHSQRQLALLLAEEDAGLKARLTDAFDRALGDAAALD
FT                   DPALAGVATPAGRFRVEALQQRVNEIRQVVAQELGPKLGVSAGFNALDGD"
     MKQLVALILC LAAAAASADP VDQVLDVHVL PGFARLADET ALLANAADAG CEERDPDLRA        60
     ALNGALRAWA GVSHLRFGPT EAENRAFALA FWPDSRGMTP KALAGLIAAE DPVVQEAEGF       120
     AQVSVAARGL YALEFLLYDE GQAGNDPYHC ALIRAIVRDS AGLARAMAAD WHDRYAALMR       180
     APGPDSPYRS RDEAMQELFK ALGTGLQITA DLRLGRPLGS FARPRPNRAE AWRAGLSLLL       240
     VIEALHSQRQ LALLLAEEDA GLKARLTDAF DRALGDAAAL DDPALAGVAT PAGRFRVEAL       300
     QQRVNEIRQV VAQELGPKLG VSAGFNALDG D                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page