(data stored in ACNUC7421 zone)

EMBL: CP000031.PE91

CP000031.PE91        Location/Qualifiers
FT   CDS             complement(90242..91147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0091"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93422"
FT                   /db_xref="GOA:Q5LWN8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWN8"
FT                   /protein_id="AAV93422.1"
FT                   /translation="MYTIAALYHFTRFADPADLKPALLDLCLAQGVKGTLLLAKEGING
FT                   TIAGPRAGIDAVLAHIRALPGCSDLEWKEATSDHPPFGKMKVRLKQEIVTMGQPDVDPR
FT                   ARVGHYVEPEDWNDLIRSDDVVLIDTRNDYEVAIGTFEGAIDPMTESFRDFPAWWEANK
FT                   ERFHNKRVAMFCTGGIRCEKSTNYLLGQGVEDVYHLKGGILRYLEEVPAENSTWQGECF
FT                   VFDNRVSVGHGLVEGPHELCHGCRRPILPEDRNRPEYEHGVSCHLCIDETSEADKMRFR
FT                   ERQKQIALARARGEDHLATH"
     MYTIAALYHF TRFADPADLK PALLDLCLAQ GVKGTLLLAK EGINGTIAGP RAGIDAVLAH        60
     IRALPGCSDL EWKEATSDHP PFGKMKVRLK QEIVTMGQPD VDPRARVGHY VEPEDWNDLI       120
     RSDDVVLIDT RNDYEVAIGT FEGAIDPMTE SFRDFPAWWE ANKERFHNKR VAMFCTGGIR       180
     CEKSTNYLLG QGVEDVYHLK GGILRYLEEV PAENSTWQGE CFVFDNRVSV GHGLVEGPHE       240
     LCHGCRRPIL PEDRNRPEYE HGVSCHLCID ETSEADKMRF RERQKQIALA RARGEDHLAT       300
     H                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page