(data stored in ACNUC7421 zone)

EMBL: CP000031.PE92

CP000031.PE92        Location/Qualifiers
FT   CDS             complement(91224..92447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0092"
FT                   /product="heat shock protein, Hsp70 family"
FT                   /note="identified by similarity to SP:P36928"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93424"
FT                   /db_xref="GOA:Q5LWN7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN7"
FT                   /protein_id="AAV93424.1"
FT                   /translation="MARLGVDFGTSNTAAGLVQAGHPRVLPLEPGAQTLPTAVFIDFAA
FT                   RRYVYGTDAARAMMDGQEGRFLRGLKSILGTPLAREPRMFLNERLTLIEVIARFLAEIR
FT                   TRAERLSGERFDRALSGRPVHFHSASAERDAQACTDLHDAYLMAGFSEVCFLPEPEAAA
FT                   LAVAGQGRMLIVDIGGGTSDFTLCDRRGTTTRMLASRGLRIGGTDFDRVLSLDHAMPLL
FT                   GYEAQIGAELGEASHSAPRALFHDLASWEKIAFVYDPATLREVRRWVRLAEQPRLFERL
FT                   AEVLESHLGHDVAYAVEAGKIAANGAAAGRIALDIVERGLGADLGNAAMQAALAGFADE
FT                   IATCAMQTVRDAGVGPDSVDQVVFVGGSSLMGVIRAALARVLPGAEQQDSEVFTAVVHG
FT                   LALASEDQ"
     MARLGVDFGT SNTAAGLVQA GHPRVLPLEP GAQTLPTAVF IDFAARRYVY GTDAARAMMD        60
     GQEGRFLRGL KSILGTPLAR EPRMFLNERL TLIEVIARFL AEIRTRAERL SGERFDRALS       120
     GRPVHFHSAS AERDAQACTD LHDAYLMAGF SEVCFLPEPE AAALAVAGQG RMLIVDIGGG       180
     TSDFTLCDRR GTTTRMLASR GLRIGGTDFD RVLSLDHAMP LLGYEAQIGA ELGEASHSAP       240
     RALFHDLASW EKIAFVYDPA TLREVRRWVR LAEQPRLFER LAEVLESHLG HDVAYAVEAG       300
     KIAANGAAAG RIALDIVERG LGADLGNAAM QAALAGFADE IATCAMQTVR DAGVGPDSVD       360
     QVVFVGGSSL MGVIRAALAR VLPGAEQQDS EVFTAVVHGL ALASEDQ                     407
//

If you have problems or comments...

PBIL Back to PBIL home page