(data stored in ACNUC7421 zone)

EMBL: CP000031.PE94

CP000031.PE94        Location/Qualifiers
FT   CDS             93264..95495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0094"
FT                   /product="sensory box sensor histidine kinase/response
FT                   regulator"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00785; match to protein family HMM PF00989;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93425"
FT                   /db_xref="GOA:Q5LWQ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ3"
FT                   /protein_id="AAV93425.1"
FT                   /translation="MHVAGSPDVDHLSEYERRYSRRGLLIRYARGRVRNFAGRQIMTFA
FT                   GSFILAMTEGLHTAMLAAFAALLGEVIDCLYLHRLPERLRQGQGYRRLLIGSTLTALVQ
FT                   ALTISFCVWLAWTGARSGLSPLFIGSFLAGAAINAGLVLPFHRPAAVARLAVYAGIGQY
FT                   LFLIEAMEPGRLGDALLLNAAGAVMLAFMVGLFLNFVNWGFRQHRRTTLDLIEQGRDLL
FT                   RHQKEAQLLSLVARNANDSVILADSEGRIVWTNESFTRTTGYSLDEAKGRYPGELLNGD
FT                   KTDLEVSNAIADAVEAGRPFRTEILNVTKDGREIWMETNLVPVLDRNGKVEVTVAIERD
FT                   VTAAKAQAEELAAARVAAEEGARAKAEFLATMSHEIRTPMNGVVGMAELLSETKLSIEQ
FT                   RQYVDTIRSSSTALLAIINDILELSRLDARKMELHPVNFDPVSCVRDTMRLLKPQAQAK
FT                   GLRLSLETGADVPPLVYGDDGRLRQVLINLLGNAIKFTERGGVTLRLRSEAQDPGYLLT
FT                   LEVEDTGIGIAAEKIERVFERFSQADADTTRLYGGTGLGLTISRELVALMGGRITVDST
FT                   LGQGSCFTLCLPLGSPDDDAGQSDGQVLSPAELDRLRGLRVLVADDNRVNRLLMGKFLA
FT                   DLPIRLDFAHDGQQAVAMTQRQKPDIVFMDMSMPVMSGIEATRQIRAAEGRQPLIVALT
FT                   ANTFDSDREACLAAGMDDFLSKPVGRADLFRCLLHHLPPTDAAPRTASG"
     MHVAGSPDVD HLSEYERRYS RRGLLIRYAR GRVRNFAGRQ IMTFAGSFIL AMTEGLHTAM        60
     LAAFAALLGE VIDCLYLHRL PERLRQGQGY RRLLIGSTLT ALVQALTISF CVWLAWTGAR       120
     SGLSPLFIGS FLAGAAINAG LVLPFHRPAA VARLAVYAGI GQYLFLIEAM EPGRLGDALL       180
     LNAAGAVMLA FMVGLFLNFV NWGFRQHRRT TLDLIEQGRD LLRHQKEAQL LSLVARNAND       240
     SVILADSEGR IVWTNESFTR TTGYSLDEAK GRYPGELLNG DKTDLEVSNA IADAVEAGRP       300
     FRTEILNVTK DGREIWMETN LVPVLDRNGK VEVTVAIERD VTAAKAQAEE LAAARVAAEE       360
     GARAKAEFLA TMSHEIRTPM NGVVGMAELL SETKLSIEQR QYVDTIRSSS TALLAIINDI       420
     LELSRLDARK MELHPVNFDP VSCVRDTMRL LKPQAQAKGL RLSLETGADV PPLVYGDDGR       480
     LRQVLINLLG NAIKFTERGG VTLRLRSEAQ DPGYLLTLEV EDTGIGIAAE KIERVFERFS       540
     QADADTTRLY GGTGLGLTIS RELVALMGGR ITVDSTLGQG SCFTLCLPLG SPDDDAGQSD       600
     GQVLSPAELD RLRGLRVLVA DDNRVNRLLM GKFLADLPIR LDFAHDGQQA VAMTQRQKPD       660
     IVFMDMSMPV MSGIEATRQI RAAEGRQPLI VALTANTFDS DREACLAAGM DDFLSKPVGR       720
     ADLFRCLLHH LPPTDAAPRT ASG                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page