(data stored in ACNUC9435 zone)

EMBL: CP000031.PE97

CP000031.PE97        Location/Qualifiers
FT   CDS             complement(97843..99294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0097"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93428"
FT                   /db_xref="GOA:Q5LWQ0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ0"
FT                   /protein_id="AAV93428.1"
FT                   /translation="MTLPLWFDPTLCLIGGRWQAPRGGDTLPLINPSDGTEICRIARGT
FT                   APDIDTAVTAAEAALAGDWGRMTATERGRILSRLGQLVLERVEDLAVIEAWDVGKPLTQ
FT                   ARADAVALARYCEFYGGAADKVMGETIPYLEGYTVYTLREPHGVTGHIVPWNYPMQIIG
FT                   RSVGAALAMGNACVLKPAEEACLTALAFADLAKQAGLPAGALNVVPGLGAEAGAALSAH
FT                   PGVHHISFTGSVATGALVQQAAGRNVVPVTLELGGKSPQLVFDDADLDTALPFLVNAGC
FT                   QNAGQTCSASSRILAQRGVYEEVKARMAASYAELTVGPAMEDLRVGPLISARQKEIVTG
FT                   FLDKGADLTIAAQGRIVDHAPETGAYVRPTLFADVPPDHALARDEIFGPVQVLIPFDTE
FT                   EEAIAIANGTDYGLVASIWTRDGARQMRLAKRLRAGQVFVNNYGAGGGVELPFGGVGKS
FT                   GHGREKGFEALYGFSQLKTVAARHG"
     MTLPLWFDPT LCLIGGRWQA PRGGDTLPLI NPSDGTEICR IARGTAPDID TAVTAAEAAL        60
     AGDWGRMTAT ERGRILSRLG QLVLERVEDL AVIEAWDVGK PLTQARADAV ALARYCEFYG       120
     GAADKVMGET IPYLEGYTVY TLREPHGVTG HIVPWNYPMQ IIGRSVGAAL AMGNACVLKP       180
     AEEACLTALA FADLAKQAGL PAGALNVVPG LGAEAGAALS AHPGVHHISF TGSVATGALV       240
     QQAAGRNVVP VTLELGGKSP QLVFDDADLD TALPFLVNAG CQNAGQTCSA SSRILAQRGV       300
     YEEVKARMAA SYAELTVGPA MEDLRVGPLI SARQKEIVTG FLDKGADLTI AAQGRIVDHA       360
     PETGAYVRPT LFADVPPDHA LARDEIFGPV QVLIPFDTEE EAIAIANGTD YGLVASIWTR       420
     DGARQMRLAK RLRAGQVFVN NYGAGGGVEL PFGGVGKSGH GREKGFEALY GFSQLKTVAA       480
     RHG                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page