(data stored in ACNUC7421 zone)

EMBL: CP000031.PE98

CP000031.PE98        Location/Qualifiers
FT   CDS             complement(99759..101357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0098"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93429"
FT                   /db_xref="GOA:Q5LWP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP9"
FT                   /protein_id="AAV93429.1"
FT                   /translation="MSLLQITDLSLSIHAYDILKRVSLTIDAGEIVAVTGESGSGKSMT
FT                   ALAVMQLLPGGARASGSIRLDGQEILTLPEAEMCALRGAAVGMVFQEPMTALNPVKTIG
FT                   DQVMETILIHKAMTPIRAEERAREVLTRVGLPPDRFPLSRYPHELSGGQRQRVVIAMAI
FT                   ALRPKLLIADEPTTALDVTTQAQILDLLKGLVQEYGMGMLMITHDLAVVADMADHITVM
FT                   RHGEVVEAAPTQRLLTGMSHPYTKMLFAASDHRVTLPAPPPPAPLLEVSEVVRDYALPR
FT                   TRLFAHPGHHRAVDHVSFALNRGERLGLVGESGCGKSTLTRAILGLEPVQGGEIRLAGQ
FT                   PVYDGKRANPEIRRRMQVVFQDPYGSFNPRHRVDRLVTEPFHLLDAPPTGSDRSDRIAE
FT                   MLTAVGLSPDDAGKYIHEFSGGQRQRIAIARALIIRPQLILFDEAVSALDVSVRAQILD
FT                   LLAQLCSEYDLTYLFISHDLSVVRTITDRVLVMQSGRIVEQGETAQVFSDPAHPYTRAL
FT                   IAAAPRLPETGARRA"
     MSLLQITDLS LSIHAYDILK RVSLTIDAGE IVAVTGESGS GKSMTALAVM QLLPGGARAS        60
     GSIRLDGQEI LTLPEAEMCA LRGAAVGMVF QEPMTALNPV KTIGDQVMET ILIHKAMTPI       120
     RAEERAREVL TRVGLPPDRF PLSRYPHELS GGQRQRVVIA MAIALRPKLL IADEPTTALD       180
     VTTQAQILDL LKGLVQEYGM GMLMITHDLA VVADMADHIT VMRHGEVVEA APTQRLLTGM       240
     SHPYTKMLFA ASDHRVTLPA PPPPAPLLEV SEVVRDYALP RTRLFAHPGH HRAVDHVSFA       300
     LNRGERLGLV GESGCGKSTL TRAILGLEPV QGGEIRLAGQ PVYDGKRANP EIRRRMQVVF       360
     QDPYGSFNPR HRVDRLVTEP FHLLDAPPTG SDRSDRIAEM LTAVGLSPDD AGKYIHEFSG       420
     GQRQRIAIAR ALIIRPQLIL FDEAVSALDV SVRAQILDLL AQLCSEYDLT YLFISHDLSV       480
     VRTITDRVLV MQSGRIVEQG ETAQVFSDPA HPYTRALIAA APRLPETGAR RA               532
//

If you have problems or comments...

PBIL Back to PBIL home page