(data stored in ACNUC7421 zone)

EMBL: CP000031.PETB

CP000031.PETB        Location/Qualifiers
FT   CDS             288773..290101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="SPO0272"
FT                   /product="ubiquinol--cytochrome c reductase, cytochrome B"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:P05418; match to
FT                   protein family HMM PF00032; match to protein family HMM
FT                   PF00033"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93592"
FT                   /db_xref="GOA:Q5LX55"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX55"
FT                   /protein_id="AAV93592.1"
FT                   /translation="MAGIPHDHYEPKTGAEKWLNSRLPIVGLIYDTIMIPTPKNLNWWW
FT                   IWGIVLAFCLALQIVTGIVLVMHYTPHVDMAFASVEHIMRNVNGGYMLRYLHANGASLF
FT                   FVAVYIHIFRGLFYGSYKAPREITWIVGMLIYLCMMGTAFMGYVLPWGQMSFWGATVIT
FT                   GLFGAIPFVGEAIQTWLLGGPAVDNATLNRFFSLHYLLPFVIAALVIVHIWAFHTTGNN
FT                   NPTGVEVRRGSKAEAEKDTLPFWPYFVIKDLVGLAIVLVIFWAIVGFMPNYLGHPDNYI
FT                   EANALVTPAHIVPEWYFLPFYAILRAFTSEVWVVQIASFVTGGIIDAKFFGVLAMFGAI
FT                   LAMALAPWLDTSSVRSGKYRPMFKWWFYLLIIDFFALMWLGAMPAEEPYASFSLIASAY
FT                   WFGYFFVILPILGVIEKPLPQPATIEEDFNAHYGTASDATPAE"
     MAGIPHDHYE PKTGAEKWLN SRLPIVGLIY DTIMIPTPKN LNWWWIWGIV LAFCLALQIV        60
     TGIVLVMHYT PHVDMAFASV EHIMRNVNGG YMLRYLHANG ASLFFVAVYI HIFRGLFYGS       120
     YKAPREITWI VGMLIYLCMM GTAFMGYVLP WGQMSFWGAT VITGLFGAIP FVGEAIQTWL       180
     LGGPAVDNAT LNRFFSLHYL LPFVIAALVI VHIWAFHTTG NNNPTGVEVR RGSKAEAEKD       240
     TLPFWPYFVI KDLVGLAIVL VIFWAIVGFM PNYLGHPDNY IEANALVTPA HIVPEWYFLP       300
     FYAILRAFTS EVWVVQIASF VTGGIIDAKF FGVLAMFGAI LAMALAPWLD TSSVRSGKYR       360
     PMFKWWFYLL IIDFFALMWL GAMPAEEPYA SFSLIASAYW FGYFFVILPI LGVIEKPLPQ       420
     PATIEEDFNA HYGTASDATP AE                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page