(data stored in ACNUC7421 zone)

EMBL: CP000031.PETC

CP000031.PETC        Location/Qualifiers
FT   CDS             290120..290983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="SPO0273"
FT                   /product="ubiquinol--cytochrome c reductase, cytochrome c1"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:Q02760; match to
FT                   protein family HMM PF02167"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93593"
FT                   /db_xref="GOA:Q5LX54"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX54"
FT                   /protein_id="AAV93593.1"
FT                   /translation="MFKKLAIGAAFALALAPVASHAAGGGEQHIEDFQFSFEGPFGTYD
FT                   QNQLQRGLQVYTEVCAACHGLKYVPLRTLGDEGGIGWTDEQVRAYASETFSVYDPELED
FT                   DRPAIPTDHFPANTGAGAPDLSLMAKARAGFHGPYGTGVNQLVRGMGGPEYIFSILTGY
FT                   EDPPACAPEEMDGYYNVAFAPGGYPDECKIFDDEGVEIGRKAPGSWISMAPPISDEQVE
FT                   FADGHANDLHHMSADVSAFLMWAAEPKMMARKQAGLVGVIFLTILASMLYLTNKRLWAP
FT                   HKGKKH"
     MFKKLAIGAA FALALAPVAS HAAGGGEQHI EDFQFSFEGP FGTYDQNQLQ RGLQVYTEVC        60
     AACHGLKYVP LRTLGDEGGI GWTDEQVRAY ASETFSVYDP ELEDDRPAIP TDHFPANTGA       120
     GAPDLSLMAK ARAGFHGPYG TGVNQLVRGM GGPEYIFSIL TGYEDPPACA PEEMDGYYNV       180
     AFAPGGYPDE CKIFDDEGVE IGRKAPGSWI SMAPPISDEQ VEFADGHAND LHHMSADVSA       240
     FLMWAAEPKM MARKQAGLVG VIFLTILASM LYLTNKRLWA PHKGKKH                     287
//

If you have problems or comments...

PBIL Back to PBIL home page