(data stored in ACNUC9435 zone)

EMBL: CP000031.PHBA

CP000031.PHBA        Location/Qualifiers
FT   CDS             complement(336736..337911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbA"
FT                   /locus_tag="SPO0326"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="identified by similarity to SP:P54810; match to
FT                   protein family HMM PF00108; match to protein family HMM
FT                   PF02803; match to protein family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93644"
FT                   /db_xref="GOA:Q5LXA8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA8"
FT                   /protein_id="AAV93644.1"
FT                   /translation="MTNVVIASAARTGVGSFGGSFANTPAHDLGAAVLEAVVERAGIDK
FT                   AEVSETILGQVLTAAQGQNPARQAHVNAGLPKESSAWGINQVCGSGLRAVALGAQHILL
FT                   GDAEIVAAGGQENMTLSPHAAALRAGHKMGDMKYIDTMIRDGLWDAFNGYHMGQTAENV
FT                   AEQWQISREMQDEFAVASQNKAEAAQNAGKFADEIVPFIIKTRKGDIVMDKDEYIRHGA
FT                   TIEAMQKLRPAFTKDGSVTAANASGLNDGAAATLLMTAENAEKRGIEPLARIASYATAG
FT                   LDPSIMGVGPIHASRKALAKAGWKVEDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNG
FT                   GAIAIGHPIGASGCRVLNTLLFEMKRRNAKKGLATLCIGGGMGVALCVERD"
     MTNVVIASAA RTGVGSFGGS FANTPAHDLG AAVLEAVVER AGIDKAEVSE TILGQVLTAA        60
     QGQNPARQAH VNAGLPKESS AWGINQVCGS GLRAVALGAQ HILLGDAEIV AAGGQENMTL       120
     SPHAAALRAG HKMGDMKYID TMIRDGLWDA FNGYHMGQTA ENVAEQWQIS REMQDEFAVA       180
     SQNKAEAAQN AGKFADEIVP FIIKTRKGDI VMDKDEYIRH GATIEAMQKL RPAFTKDGSV       240
     TAANASGLND GAAATLLMTA ENAEKRGIEP LARIASYATA GLDPSIMGVG PIHASRKALA       300
     KAGWKVEDLD LVEANEAFAA QACAVNKDMG WDPAIVNVNG GAIAIGHPIG ASGCRVLNTL       360
     LFEMKRRNAK KGLATLCIGG GMGVALCVER D                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page