(data stored in ACNUC7421 zone)

EMBL: CP000031.PHBB

CP000031.PHBB        Location/Qualifiers
FT   CDS             complement(335827..336549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="SPO0325"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="identified by similarity to SP:P23238; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   TIGR01829"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93643"
FT                   /db_xref="GOA:Q5LXA9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA9"
FT                   /protein_id="AAV93643.1"
FT                   /translation="MARTALVTGGSRGIGAAISKALKAEGYNVAATYAGNDEAATAFTA
FT                   ETGIATYKWNVADYDESAAGIAKVEAEVGPIDIVVANAGITRDAPFHKMTPEQWHQVID
FT                   TNLTGVFNTVHPVWPGMRERKFGRVIVISSINGQKGQFAQVNYAATKAGDLGIVKSLAQ
FT                   EGARAGITANAICPGYIATEMVMAIPEKVRDSIVAGIPAGRLGEPEEIARCVTFLASED
FT                   SGFINGSTISANGAQFFV"
     MARTALVTGG SRGIGAAISK ALKAEGYNVA ATYAGNDEAA TAFTAETGIA TYKWNVADYD        60
     ESAAGIAKVE AEVGPIDIVV ANAGITRDAP FHKMTPEQWH QVIDTNLTGV FNTVHPVWPG       120
     MRERKFGRVI VISSINGQKG QFAQVNYAAT KAGDLGIVKS LAQEGARAGI TANAICPGYI       180
     ATEMVMAIPE KVRDSIVAGI PAGRLGEPEE IARCVTFLAS EDSGFINGST ISANGAQFFV       240
//

If you have problems or comments...

PBIL Back to PBIL home page