(data stored in ACNUC7421 zone)

EMBL: CP000031.PHNG

CP000031.PHNG        Location/Qualifiers
FT   CDS             475557..476012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="SPO0468"
FT                   /product="alkylphosphonate utilization protein PhnG"
FT                   /note="identified by similarity to SP:P16685"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93786"
FT                   /db_xref="GOA:Q5LW74"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW74"
FT                   /protein_id="AAV93786.1"
FT                   /translation="MAEQEKETAARQGWMGLLARAPEAMLMALWNRVEERPAFDWLRAP
FT                   ETGGVMVRGRAGGTGAPFNLGEMTVTRCALALADGTVGHAYVQGRSRAKAEAAALIDAL
FT                   MQTAAADTIRALVLDPLAAQMAERSEGRAARAAATKVEFFTLVRGED"
     MAEQEKETAA RQGWMGLLAR APEAMLMALW NRVEERPAFD WLRAPETGGV MVRGRAGGTG        60
     APFNLGEMTV TRCALALADG TVGHAYVQGR SRAKAEAAAL IDALMQTAAA DTIRALVLDP       120
     LAAQMAERSE GRAARAAATK VEFFTLVRGE D                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page