(data stored in ACNUC7421 zone)

EMBL: CP000031.PHNH

CP000031.PHNH        Location/Qualifiers
FT   CDS             476009..476587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="SPO0469"
FT                   /product="alkylphosphonate utilization protein PhnH"
FT                   /note="identified by similarity to SP:P16686"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93787"
FT                   /db_xref="GOA:Q5LW73"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW73"
FT                   /protein_id="AAV93787.1"
FT                   /translation="MMDGSSLYAGGFRDAPVDAAHAFRAAMSAMARPGDIRRIAGAEPP
FT                   APLSVAAGTLLLTLCDPETRVHLAGAVDTDAVRQWLSFHTGAPLVDAAEADFALGSWAD
FT                   LMPLSRYRIGTPEYPDRSAALIVECDALENTGAVLSGPGIRDTARLSLPDVDTLKGNAI
FT                   LYPLGCDFFFTCGDRVAALPRSTTIVAEG"
     MMDGSSLYAG GFRDAPVDAA HAFRAAMSAM ARPGDIRRIA GAEPPAPLSV AAGTLLLTLC        60
     DPETRVHLAG AVDTDAVRQW LSFHTGAPLV DAAEADFALG SWADLMPLSR YRIGTPEYPD       120
     RSAALIVECD ALENTGAVLS GPGIRDTARL SLPDVDTLKG NAILYPLGCD FFFTCGDRVA       180
     ALPRSTTIVA EG                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page