(data stored in ACNUC7421 zone)

EMBL: CP000031.PHNJ

CP000031.PHNJ        Location/Qualifiers
FT   CDS             477762..478598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="SPO0471"
FT                   /product="alkylphosphonate utilization protein PhnJ"
FT                   /note="identified by similarity to SP:P16688"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93789"
FT                   /db_xref="GOA:Q5LW71"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW71"
FT                   /protein_id="AAV93789.1"
FT                   /translation="MTEQAYNFAYLDEQTKRMIRRAILKGLAVPGYQVPFASREMPMPY
FT                   GWGTGGVQVSAATLTPDDRLKVIDQGADDTTNAVSIRKFFERTAGVATTEATQEATVIQ
FT                   TRHRIPEAELTEDQILVYQVPIPEPLRFLEPRETETRKMHSLQEYGLMHVKLYEDISQH
FT                   GAISTAYAYPVRVAERYVMDPSPIPKFDNPKMEMAAIQLFGAGREQRIYAVPPYTRVVS
FT                   LDFEDYPFEATKAEHPCDLCGAEDSYLDEVIMDDAGGRMFVCSDTDYCRSRREAAA"
     MTEQAYNFAY LDEQTKRMIR RAILKGLAVP GYQVPFASRE MPMPYGWGTG GVQVSAATLT        60
     PDDRLKVIDQ GADDTTNAVS IRKFFERTAG VATTEATQEA TVIQTRHRIP EAELTEDQIL       120
     VYQVPIPEPL RFLEPRETET RKMHSLQEYG LMHVKLYEDI SQHGAISTAY AYPVRVAERY       180
     VMDPSPIPKF DNPKMEMAAI QLFGAGREQR IYAVPPYTRV VSLDFEDYPF EATKAEHPCD       240
     LCGAEDSYLD EVIMDDAGGR MFVCSDTDYC RSRREAAA                               278
//

If you have problems or comments...

PBIL Back to PBIL home page