(data stored in ACNUC9435 zone)

EMBL: CP000031.PHNL

CP000031.PHNL        Location/Qualifiers
FT   CDS             479522..480205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="SPO0473"
FT                   /product="alkylphosphonate utilization protein PhnL"
FT                   /note="identified by similarity to SP:P16679"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93791"
FT                   /db_xref="GOA:Q5LW69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW69"
FT                   /protein_id="AAV93791.1"
FT                   /translation="MIDIRDVSKSFTLHNQGSAVIRVMEGASLHVAPGECVALTGASGA
FT                   GKSTLMRVIYGNYLAASGSVLVGGLDVVQAEPREILQLRREVLGYVSQFLRVVPRVPTV
FT                   EVVAEPLLALGADPDAARARAEALLSRLNIPERLWKLSPTTFSGGEQQRVNIARGFAHA
FT                   YPALLLDEPTASLDAANRAVVLELIEEAKARGAAIVGIFHDVEARARVCDRVVDVSAFT
FT                   PGAAA"
     MIDIRDVSKS FTLHNQGSAV IRVMEGASLH VAPGECVALT GASGAGKSTL MRVIYGNYLA        60
     ASGSVLVGGL DVVQAEPREI LQLRREVLGY VSQFLRVVPR VPTVEVVAEP LLALGADPDA       120
     ARARAEALLS RLNIPERLWK LSPTTFSGGE QQRVNIARGF AHAYPALLLD EPTASLDAAN       180
     RAVVLELIEE AKARGAAIVG IFHDVEARAR VCDRVVDVSA FTPGAAA                     227
//

If you have problems or comments...

PBIL Back to PBIL home page