(data stored in ACNUC9435 zone)

EMBL: CP000031.PHNN

CP000031.PHNN        Location/Qualifiers
FT   CDS             480202..480750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnN"
FT                   /locus_tag="SPO0474"
FT                   /product="alkylphosphonate utilization protein PhnN"
FT                   /note="identified by similarity to SP:P16690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93792"
FT                   /db_xref="GOA:Q5LW68"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW68"
FT                   /protein_id="AAV93792.1"
FT                   /translation="MTQVPVIAVVGPSGVGKDSVMTALATRDPRVHLIRRVITRPEDAG
FT                   GEAFTGVSRQEFEAMRAAGAFALSWEAHGLCYGVPMPSEVKQADARALLVNLSRGVLLR
FT                   AQEVFHPFAVLSLTARPEVLAARLAARGREDAAEQARRLGRAGMALPEGVRRVITVDNS
FT                   GPLERTVDAVLAHLQRESA"
     MTQVPVIAVV GPSGVGKDSV MTALATRDPR VHLIRRVITR PEDAGGEAFT GVSRQEFEAM        60
     RAAGAFALSW EAHGLCYGVP MPSEVKQADA RALLVNLSRG VLLRAQEVFH PFAVLSLTAR       120
     PEVLAARLAA RGREDAAEQA RRLGRAGMAL PEGVRRVITV DNSGPLERTV DAVLAHLQRE       180
     SA                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page