(data stored in ACNUC7421 zone)

EMBL: CP000031.PNCA

CP000031.PNCA        Location/Qualifiers
FT   CDS             92595..93185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="SPO0093"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="identified by similarity to SP:P21369; match to
FT                   protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93423"
FT                   /db_xref="GOA:Q5LWN6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN6"
FT                   /protein_id="AAV93423.1"
FT                   /translation="MHGLIVIDVQNDFCPGGALAVPEGDAVVAPINAMMKDFDAVVLTQ
FT                   DWHPAGHSSFASSHPGQAPFEMIEMAYGPQVLWPDHCVQGSPGAAFHPALRTDADLILR
FT                   KGFRAAIDSYSGFFENDRSTPTGLEGYLRSRGITRLTLAGLATDFCVQYSALDAARLGF
FT                   AVEVRMQACRAIDLDGSLAAAIAAMKAGGIALT"
     MHGLIVIDVQ NDFCPGGALA VPEGDAVVAP INAMMKDFDA VVLTQDWHPA GHSSFASSHP        60
     GQAPFEMIEM AYGPQVLWPD HCVQGSPGAA FHPALRTDAD LILRKGFRAA IDSYSGFFEN       120
     DRSTPTGLEG YLRSRGITRL TLAGLATDFC VQYSALDAAR LGFAVEVRMQ ACRAIDLDGS       180
     LAAAIAAMKA GGIALT                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page