(data stored in ACNUC7421 zone)

EMBL: CP000031.PNCB

CP000031.PNCB        Location/Qualifiers
FT   CDS             95526..96869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="SPO0095"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="identified by similarity to SP:P18133; match to
FT                   protein family HMM PF04095"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93426"
FT                   /db_xref="GOA:Q5LWQ2"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ2"
FT                   /protein_id="AAV93426.1"
FT                   /translation="MAVRLAYPWVIHSERGPSVDIATRVYNHKWKIDPIVRSLIDTDFY
FT                   KLLMCQSVFRNKPDTQVTFSLINRTMRIPLARIIDEGELREQLDHIRSLRLSRGESTWL
FT                   RGNTFYGKRQMFRPDFMEWFEGLQLPPYHLERRDDQYELTFEGNWPEVMLWEIPALAVL
FT                   MELRSRAVLHDMRRFELQVLYARAMTRVWEKIERLRGIDGLTIADFGTRRRHSFLWQDW
FT                   CVQAMIEGLGAKFTGTSNCLIAMRREVEAIGTNAHELPMVYSALAETDTELARAPYDVL
FT                   SDWHEEHDGNLRIILPDTYGTKGFLDRAPDWLAGWTGIRIDSGDPAEGAETAISWWKDR
FT                   GENPTDKRIIFSDGLDVDKIAELHARFSGRAKISFGWGTLLTNDFRGLVPDDGLAPFSL
FT                   VCKAVSANGHPTVKLSDNPEKAMGPADEVARYKRVFGVGRQTSYAVEV"
     MAVRLAYPWV IHSERGPSVD IATRVYNHKW KIDPIVRSLI DTDFYKLLMC QSVFRNKPDT        60
     QVTFSLINRT MRIPLARIID EGELREQLDH IRSLRLSRGE STWLRGNTFY GKRQMFRPDF       120
     MEWFEGLQLP PYHLERRDDQ YELTFEGNWP EVMLWEIPAL AVLMELRSRA VLHDMRRFEL       180
     QVLYARAMTR VWEKIERLRG IDGLTIADFG TRRRHSFLWQ DWCVQAMIEG LGAKFTGTSN       240
     CLIAMRREVE AIGTNAHELP MVYSALAETD TELARAPYDV LSDWHEEHDG NLRIILPDTY       300
     GTKGFLDRAP DWLAGWTGIR IDSGDPAEGA ETAISWWKDR GENPTDKRII FSDGLDVDKI       360
     AELHARFSGR AKISFGWGTL LTNDFRGLVP DDGLAPFSLV CKAVSANGHP TVKLSDNPEK       420
     AMGPADEVAR YKRVFGVGRQ TSYAVEV                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page