(data stored in ACNUC7421 zone)

EMBL: CP000031.RADC

CP000031.RADC        Location/Qualifiers
FT   CDS             53600..54274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="SPO0054"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by similarity to SP:P25531; match to
FT                   protein family HMM PF04002; match to protein family HMM
FT                   TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93385"
FT                   /db_xref="GOA:Q5LWK3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWK3"
FT                   /protein_id="AAV93385.1"
FT                   /translation="MPSYIRDHRKRLRERFMTGGAAALPDYELLELVLFRSIPRQDVKP
FT                   LARLLLDTFGDFNRVLTAPVERLAEVKGVGEAVITDLKILEASAHRMARARVMQRQVIS
FT                   SWDALLDYCHTTMAHRETEQFRVFYLDRKNVLIADEEQARGTVDHVPVYPREVAKRALE
FT                   LNASALILVHNHPSGDPTPSQSDIDMTARIRSACEALGLTLHDHLIIGKSVELSFRAEG
FT                   YL"
     MPSYIRDHRK RLRERFMTGG AAALPDYELL ELVLFRSIPR QDVKPLARLL LDTFGDFNRV        60
     LTAPVERLAE VKGVGEAVIT DLKILEASAH RMARARVMQR QVISSWDALL DYCHTTMAHR       120
     ETEQFRVFYL DRKNVLIADE EQARGTVDHV PVYPREVAKR ALELNASALI LVHNHPSGDP       180
     TPSQSDIDMT ARIRSACEAL GLTLHDHLII GKSVELSFRA EGYL                        224
//

If you have problems or comments...

PBIL Back to PBIL home page