(data stored in ACNUC9435 zone)

EMBL: CP000031.RBSK

CP000031.RBSK        Location/Qualifiers
FT   CDS             13857..14729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="SPO0013"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="identified by similarity to SP:P05054; match to
FT                   protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93344"
FT                   /db_xref="GOA:Q5LWG8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG8"
FT                   /protein_id="AAV93344.1"
FT                   /translation="MAIWNLGSINADMVYAVPHLPGPGETLAASGLERFLGGKGANMSV
FT                   AAARAGSQVRHIGAVGPEGRWAIDRLTEYGVDTRHIATLEAPTGHAIIAVEPGGENLIV
FT                   LLPGANRAISPERVGSVLLDAAPGDLLVMQNETSAQVEAARLGRERGLTVCYAAAPFDA
FT                   QAVRDVLPWLDFLILNAVEAEQLQEATGLTPDQLPVSHVIVTLGSKGARHFDTDKGIST
FT                   EYPAYRVKAVDTTGAGDTFTGYVLSGMDRGLPMPQAITQAMRAAALMVMRHGTADVIPD
FT                   LKEVLAARF"
     MAIWNLGSIN ADMVYAVPHL PGPGETLAAS GLERFLGGKG ANMSVAAARA GSQVRHIGAV        60
     GPEGRWAIDR LTEYGVDTRH IATLEAPTGH AIIAVEPGGE NLIVLLPGAN RAISPERVGS       120
     VLLDAAPGDL LVMQNETSAQ VEAARLGRER GLTVCYAAAP FDAQAVRDVL PWLDFLILNA       180
     VEAEQLQEAT GLTPDQLPVS HVIVTLGSKG ARHFDTDKGI STEYPAYRVK AVDTTGAGDT       240
     FTGYVLSGMD RGLPMPQAIT QAMRAAALMV MRHGTADVIP DLKEVLAARF                  290
//

If you have problems or comments...

PBIL Back to PBIL home page