(data stored in ACNUC7421 zone)

EMBL: CP000031.RECF

CP000031.RECF        Location/Qualifiers
FT   CDS             167177..168277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SPO0151"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P13456; match to
FT                   protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93479"
FT                   /db_xref="GOA:Q5LWV2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV2"
FT                   /protein_id="AAV93479.1"
FT                   /translation="MALALTAITISHFRSHRLLRLSLDERPVAIHGPNGAGKTNILEAV
FT                   SMFSPGRGMRRASAAEMTRRPEVLGWKLSAELVAGHQRHEIETWSEGGAARQVRIDDKA
FT                   ASQVALGRLVRMVWLVPSMDRLWIEGPEGRRRFLDRMTMSFEPDHAEAVLVYEKAMRER
FT                   NRLLREQVRDAHWYLALETQMAAAGHRIHAARQSTLTALAAAQTQAETSFPTAELELIQ
FT                   TEGALPESEGDLREALAESRFRDLAAGRTLVGPHRSDLYGVYAAKGVPASDCSTGEQKA
FT                   LLVSLILANARALARQVGAPPVLLLDEIAAHLDAGRRAALYDEICALGAQAWMTGTGPE
FT                   LFSELGARAQTIALCERDGQSEVVET"
     MALALTAITI SHFRSHRLLR LSLDERPVAI HGPNGAGKTN ILEAVSMFSP GRGMRRASAA        60
     EMTRRPEVLG WKLSAELVAG HQRHEIETWS EGGAARQVRI DDKAASQVAL GRLVRMVWLV       120
     PSMDRLWIEG PEGRRRFLDR MTMSFEPDHA EAVLVYEKAM RERNRLLREQ VRDAHWYLAL       180
     ETQMAAAGHR IHAARQSTLT ALAAAQTQAE TSFPTAELEL IQTEGALPES EGDLREALAE       240
     SRFRDLAAGR TLVGPHRSDL YGVYAAKGVP ASDCSTGEQK ALLVSLILAN ARALARQVGA       300
     PPVLLLDEIA AHLDAGRRAA LYDEICALGA QAWMTGTGPE LFSELGARAQ TIALCERDGQ       360
     SEVVET                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page