(data stored in ACNUC9435 zone)

EMBL: CP000031.RECQ

CP000031.RECQ        Location/Qualifiers
FT   CDS             complement(110244..112283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="SPO0107"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM TIGR00614;
FT                   match to protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93438"
FT                   /db_xref="GOA:Q5LWQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ8"
FT                   /protein_id="AAV93438.1"
FT                   /translation="MFDAAPLLRDVFGFDAFRPGQEEIAQAVAEGENVLAIMPTGGGKS
FT                   LCFQLPALMREGVTVVISPLIALMRDQVRSLQEAGVEAGALTSGNTPEETEAVWQALEA
FT                   GRLKLLYMAPERLASGAAMGMLRRIGVSLIAVDEAHCVSQWGHDFRPDYLRIGELRRAL
FT                   GVPLAAFTATADAETQAEIVAKLFDGEEPRSFLRGFDRPNIHLAFAAKDSPRRQILDFA
FT                   GARRGQSGIVYCGTRAKTETLAQALREDGHSACHYHGGMEAEDRRIVETRFAREDGLIV
FT                   VATVAFGMGIDKPDIRWVAHADLPKSIEAYYQEIGRAGRDGGPAETLTLFGPDDIRLRR
FT                   SQIDEGLAPPERRAADHARLNALLGLAEAMTCRRQTLLGYFGETEITCGKCDLCDSPAE
FT                   RFDGTTAVRMALSAMLRTEEWFGATHLIDILLGNQTDKIRDRRHDQLPTYGVGTEWNRA
FT                   QWQAIFRQMMGRDLVRPDPERHGALRMTEAALPILRGEAGIELRKDTVSKAARRPAVKA
FT                   MVNDEDAPLLSALKAKRRALAEAARVPAYVIFPDRTLIEMAEKRPASLDQMARIGGIGA
FT                   KKLERYGAMFLEVVSGAAEMLHPARRKLAGRQTGNIYDRLLAVQADLARGPDGIDKPLS
FT                   CSASQLAKVAQMRPDDRSGLEALLGDRRWERFGEAFLDVLGQTT"
     MFDAAPLLRD VFGFDAFRPG QEEIAQAVAE GENVLAIMPT GGGKSLCFQL PALMREGVTV        60
     VISPLIALMR DQVRSLQEAG VEAGALTSGN TPEETEAVWQ ALEAGRLKLL YMAPERLASG       120
     AAMGMLRRIG VSLIAVDEAH CVSQWGHDFR PDYLRIGELR RALGVPLAAF TATADAETQA       180
     EIVAKLFDGE EPRSFLRGFD RPNIHLAFAA KDSPRRQILD FAGARRGQSG IVYCGTRAKT       240
     ETLAQALRED GHSACHYHGG MEAEDRRIVE TRFAREDGLI VVATVAFGMG IDKPDIRWVA       300
     HADLPKSIEA YYQEIGRAGR DGGPAETLTL FGPDDIRLRR SQIDEGLAPP ERRAADHARL       360
     NALLGLAEAM TCRRQTLLGY FGETEITCGK CDLCDSPAER FDGTTAVRMA LSAMLRTEEW       420
     FGATHLIDIL LGNQTDKIRD RRHDQLPTYG VGTEWNRAQW QAIFRQMMGR DLVRPDPERH       480
     GALRMTEAAL PILRGEAGIE LRKDTVSKAA RRPAVKAMVN DEDAPLLSAL KAKRRALAEA       540
     ARVPAYVIFP DRTLIEMAEK RPASLDQMAR IGGIGAKKLE RYGAMFLEVV SGAAEMLHPA       600
     RRKLAGRQTG NIYDRLLAVQ ADLARGPDGI DKPLSCSASQ LAKVAQMRPD DRSGLEALLG       660
     DRRWERFGEA FLDVLGQTT                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page