(data stored in ACNUC9435 zone)

EMBL: CP000031.RIBH-1

CP000031.RIBH-1      Location/Qualifiers
FT   CDS             complement(285959..286696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH-1"
FT                   /locus_tag="SPO0268"
FT                   /product="riboflavin synthase, beta subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by similarity to SP:P50856; match to
FT                   protein family HMM PF00885"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93588"
FT                   /db_xref="GOA:Q5LX59"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX59"
FT                   /protein_id="AAV93588.1"
FT                   /translation="MHDGPPVAPISSCSGERSLASSVSFSGRGEIPHRRYAGLDPASPR
FT                   AAPAHVRGVSRSGERPEPTVTVRMKENARPGHASACARPFVIALGDVSKHKEITMTHTR
FT                   YAFIKANWHADIVDRALEGFLELIPPEQVDVYDVPGAFEMPLLARDLAQTGRYAAVACA
FT                   AFVVDGGIYRHDFVAQAVVDGLMRAGLDTGVPILSVSLTPHQYQETDHHNAIFRAHFVD
FT                   KGREAARAALQITATRSKLAQAA"
     MHDGPPVAPI SSCSGERSLA SSVSFSGRGE IPHRRYAGLD PASPRAAPAH VRGVSRSGER        60
     PEPTVTVRMK ENARPGHASA CARPFVIALG DVSKHKEITM THTRYAFIKA NWHADIVDRA       120
     LEGFLELIPP EQVDVYDVPG AFEMPLLARD LAQTGRYAAV ACAAFVVDGG IYRHDFVAQA       180
     VVDGLMRAGL DTGVPILSVS LTPHQYQETD HHNAIFRAHF VDKGREAARA ALQITATRSK       240
     LAQAA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page