(data stored in ACNUC7421 zone)

EMBL: CP000031.RLUC

CP000031.RLUC        Location/Qualifiers
FT   CDS             512820..513863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="SPO0516"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="4.2.1.70"
FT                   /note="identified by similarity to SP:P23851"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93833"
FT                   /db_xref="GOA:Q5LW27"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW27"
FT                   /protein_id="AAV93833.1"
FT                   /translation="MSGVQMITVGEGDGDQRLDRWFRRMFPHVGQGRIEKMCRKGELRV
FT                   DGARAKPATRLEVGQQVRIPPLPAPGERPEPVKSRVSDSDAKLIRACVLHRDDDIIVLN
FT                   KPAGLAVQGGSGQTRHVDGLSEALRFGNDENPRLVHRLDKDTSGVLVLARTREAAARLT
FT                   AAFRHRNTRKIYWALVAGVPTPYLGEIKTGLVKAGGHGARGEGEKMNVVHLSELDATPG
FT                   AKRAHTYYATLYRVAGRASWVAMEPVTGRTHQLRAHMAGIGHPIIGDGKYGGSGQENLG
FT                   DGWGAQLGGIISKKLHLHARSLSFEHPSTRKKVTFTAPLPEHMRESWDTFGWTEDLAAE
FT                   DPFEELM"
     MSGVQMITVG EGDGDQRLDR WFRRMFPHVG QGRIEKMCRK GELRVDGARA KPATRLEVGQ        60
     QVRIPPLPAP GERPEPVKSR VSDSDAKLIR ACVLHRDDDI IVLNKPAGLA VQGGSGQTRH       120
     VDGLSEALRF GNDENPRLVH RLDKDTSGVL VLARTREAAA RLTAAFRHRN TRKIYWALVA       180
     GVPTPYLGEI KTGLVKAGGH GARGEGEKMN VVHLSELDAT PGAKRAHTYY ATLYRVAGRA       240
     SWVAMEPVTG RTHQLRAHMA GIGHPIIGDG KYGGSGQENL GDGWGAQLGG IISKKLHLHA       300
     RSLSFEHPST RKKVTFTAPL PEHMRESWDT FGWTEDLAAE DPFEELM                     347
//

If you have problems or comments...

PBIL Back to PBIL home page