(data stored in ACNUC7421 zone)

EMBL: CP000031.RPH

CP000031.RPH         Location/Qualifiers
FT   CDS             complement(6294..7007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="SPO0008"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by similarity to SP:P03842; match to
FT                   protein family HMM PF01138; match to protein family HMM
FT                   PF03725; match to protein family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93339"
FT                   /db_xref="GOA:Q5LWF6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWF6"
FT                   /protein_id="AAV93339.1"
FT                   /translation="MRPSGRDLSEMRPVSIETGFTKHAEGSCLIKMGDTHVLCTATIED
FT                   RVPPFIKGSGLGWVTAEYGMLPRATNTRMRREAASGKQGGRTVEIQRLIGRALRAGVDR
FT                   VALGERQITVDCDVIQADGGTRCASITGGWVALRLAVNKLMKAGDVISDPLVDPVAAVS
FT                   CGIYAGQPVLDLDYPEDSEAGVDGNFIMTGSGKLIEVQMSAEGSVFNRAQLDQLLGLAE
FT                   KGVGELVAAQMAATA"
     MRPSGRDLSE MRPVSIETGF TKHAEGSCLI KMGDTHVLCT ATIEDRVPPF IKGSGLGWVT        60
     AEYGMLPRAT NTRMRREAAS GKQGGRTVEI QRLIGRALRA GVDRVALGER QITVDCDVIQ       120
     ADGGTRCASI TGGWVALRLA VNKLMKAGDV ISDPLVDPVA AVSCGIYAGQ PVLDLDYPED       180
     SEAGVDGNFI MTGSGKLIEV QMSAEGSVFN RAQLDQLLGL AEKGVGELVA AQMAATA          237
//

If you have problems or comments...

PBIL Back to PBIL home page