(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLB

CP000031.RPLB        Location/Qualifiers
FT   CDS             487568..488410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SPO0484"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by similarity to SP:P02387"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93801"
FT                   /db_xref="GOA:Q5LW59"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW59"
FT                   /protein_id="AAV93801.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKSGGRNN
FT                   TGRITSRRRGGGAKRLYRIVDFKRNKFDVAATVERIEYDPNRTAFIALIKYEDGEQAYI
FT                   LAPQRLAVGDKVVASAKADIKPGNAMPFSGMPIGTIVHNIEMKPGKGGQIARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNYGKAGRMRHKGIRPSVRG
FT                   VAMNPIDHPHGGGEGRTSGGRTPVTPWGKDTKGTRTRNKNKASQKLIIRSRHAKKKGR"
     MALKSYKPTT PGQRGLVLID RSELWKGRPV KSLTEGLTKS GGRNNTGRIT SRRRGGGAKR        60
     LYRIVDFKRN KFDVAATVER IEYDPNRTAF IALIKYEDGE QAYILAPQRL AVGDKVVASA       120
     KADIKPGNAM PFSGMPIGTI VHNIEMKPGK GGQIARAAGT YAQFVGRDGG YAQIRLSSGE       180
     LRMVRQECMA TVGAVSNPDN SNQNYGKAGR MRHKGIRPSV RGVAMNPIDH PHGGGEGRTS       240
     GGRTPVTPWG KDTKGTRTRN KNKASQKLII RSRHAKKKGR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page