(data stored in ACNUC9435 zone)

EMBL: CP000031.RPLE

CP000031.RPLE        Location/Qualifiers
FT   CDS             497896..498456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SPO0497"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to SP:P12877"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93814"
FT                   /db_xref="GOA:Q5LW46"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW46"
FT                   /protein_id="AAV93814.1"
FT                   /translation="MLDAANYTPRLKAQYAETIRAALKEEFGYKNDMMIPKLEKIVLNI
FT                   GCGAEAVKDSKKAKSAQEDLSKIAGQKAITTTAKKSIAGFRVREDMPMGAKVTLRGERM
FT                   YEFLDRLITIAMPRIRDFRGVKPSFDGRGNFAMGIKEHIVFPEIDFDKVDEVWGMDIVI
FT                   ATTAKTDAEAKSLLKHFNMPFNA"
     MLDAANYTPR LKAQYAETIR AALKEEFGYK NDMMIPKLEK IVLNIGCGAE AVKDSKKAKS        60
     AQEDLSKIAG QKAITTTAKK SIAGFRVRED MPMGAKVTLR GERMYEFLDR LITIAMPRIR       120
     DFRGVKPSFD GRGNFAMGIK EHIVFPEIDF DKVDEVWGMD IVIATTAKTD AEAKSLLKHF       180
     NMPFNA                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page