(data stored in ACNUC9435 zone)

EMBL: CP000031.RPLO

CP000031.RPLO        Location/Qualifiers
FT   CDS             502959..503432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SPO0505"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by similarity to SP:P19946"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93822"
FT                   /db_xref="GOA:Q5LW38"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW38"
FT                   /protein_id="AAV93822.2"
FT                   /translation="MKLHELSDNPGATKKRMRIGRGPGSGKGKMGGRGIKGQKSRSGVA
FT                   INGYEGGQMPLYQRLPKRGFNKPNRKAFAVVNLGLIQKFVEAGKLDGAAAITEDALVAS
FT                   GLVRRKLDGIRVLAKGDFNAKLNIEVTGASKSAVEAVEKAGGSLKVTNAAAAE"
     MKLHELSDNP GATKKRMRIG RGPGSGKGKM GGRGIKGQKS RSGVAINGYE GGQMPLYQRL        60
     PKRGFNKPNR KAFAVVNLGL IQKFVEAGKL DGAAAITEDA LVASGLVRRK LDGIRVLAKG       120
     DFNAKLNIEV TGASKSAVEA VEKAGGSLKV TNAAAAE                                157
//

If you have problems or comments...

PBIL Back to PBIL home page