(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLQ

CP000031.RPLQ        Location/Qualifiers
FT   CDS             508954..509376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SPO0512"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to SP:P02416"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93829"
FT                   /db_xref="GOA:Q5LW31"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW31"
FT                   /protein_id="AAV93829.1"
FT                   /translation="MRHARGYRRLNRTHEHRKALFANMAGSLIEHEQIKTTLPKAKELR
FT                   PIVEKLITLGKRGDLHARRQAAAQLKEDKDVAKLFDVLAERYKDRQGGYVRILKAGFRY
FT                   GDMAPMAIIEFVDRDVDAKGAADKARLAEEEAAAEE"
     MRHARGYRRL NRTHEHRKAL FANMAGSLIE HEQIKTTLPK AKELRPIVEK LITLGKRGDL        60
     HARRQAAAQL KEDKDVAKLF DVLAERYKDR QGGYVRILKA GFRYGDMAPM AIIEFVDRDV       120
     DAKGAADKAR LAEEEAAAEE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page