(data stored in ACNUC9435 zone)

EMBL: CP000031.RPLR

CP000031.RPLR        Location/Qualifiers
FT   CDS             499742..500101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SPO0501"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by similarity to SP:P46899"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93818"
FT                   /db_xref="GOA:Q5LW42"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW42"
FT                   /protein_id="AAV93818.1"
FT                   /translation="MANSKRTLFLKRRLRVRNKLRKVNAGRLRLSVHRSNKNISAQLID
FT                   DVRGVTLAAASTMEKDLGVVGKNNVEAAKKVGAAIAERAKKAGVEEAYFDRGGFLFHGK
FT                   VKALADAAREGGLKI"
     MANSKRTLFL KRRLRVRNKL RKVNAGRLRL SVHRSNKNIS AQLIDDVRGV TLAAASTMEK        60
     DLGVVGKNNV EAAKKVGAAI AERAKKAGVE EAYFDRGGFL FHGKVKALAD AAREGGLKI        119
//

If you have problems or comments...

PBIL Back to PBIL home page