(data stored in ACNUC7421 zone)

EMBL: CP000031.RPLX

CP000031.RPLX        Location/Qualifiers
FT   CDS             497592..497903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SPO0496"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by similarity to SP:P12876"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93813"
FT                   /db_xref="GOA:Q5LW47"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW47"
FT                   /protein_id="AAV93813.1"
FT                   /translation="MAAKLRKGDKVVVLAGKDKGKEGTITSVDPKAGKAVVDGVNIAIR
FT                   HTRQTQTSQGGRLPKALPIDLSNLALLDKNGKATRVGFRMEGDKKVRFAKTTGDVIDA"
     MAAKLRKGDK VVVLAGKDKG KEGTITSVDP KAGKAVVDGV NIAIRHTRQT QTSQGGRLPK        60
     ALPIDLSNLA LLDKNGKATR VGFRMEGDKK VRFAKTTGDV IDA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page