(data stored in ACNUC7421 zone)

EMBL: CP000031.RPMC

CP000031.RPMC        Location/Qualifiers
FT   CDS             496675..496875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SPO0493"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by similarity to SP:P04457"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93810"
FT                   /db_xref="GOA:Q5LW50"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW50"
FT                   /protein_id="AAV93810.1"
FT                   /translation="MNAQELRNKTPDQLREDLVTLKKEAFNLRFQQATGQLENNARIRT
FT                   VRRDVARVMTVLNEKAAEAAN"
     MNAQELRNKT PDQLREDLVT LKKEAFNLRF QQATGQLENN ARIRTVRRDV ARVMTVLNEK        60
     AAEAAN                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page