(data stored in ACNUC7421 zone)

EMBL: CP000031.RPOH-1

CP000031.RPOH-1      Location/Qualifiers
FT   CDS             418384..419262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH-1"
FT                   /locus_tag="SPO0406"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by similarity to SP:P48194; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93724"
FT                   /db_xref="GOA:Q5LWD6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD6"
FT                   /protein_id="AAV93724.1"
FT                   /translation="MALNDPQDKRMSRQAMKAELLDAETELALAYAWRDHRDEAALHRL
FT                   ITAYMRLAISMAAKFKRYGAPMNDLIQEAGLGLMKAADKFDPDRGVRFSTYAVWWIKAS
FT                   IQDYVMRNWSMVRTGSTSSQKSLFFNMRRVQARLEREAATDGLALDRHQLHQMIASEIG
FT                   VPLRDVEMMEGRLSGSDFSLNATQASDEEGREWIEALEDESEQAAELVAHRHDTEQLRD
FT                   WLIEAMQALNERERFIVRERKLRDEPRTLESLGDELGLSKERVRQLEAAAFAKMRKSLE
FT                   ARSREVQHFLV"
     MALNDPQDKR MSRQAMKAEL LDAETELALA YAWRDHRDEA ALHRLITAYM RLAISMAAKF        60
     KRYGAPMNDL IQEAGLGLMK AADKFDPDRG VRFSTYAVWW IKASIQDYVM RNWSMVRTGS       120
     TSSQKSLFFN MRRVQARLER EAATDGLALD RHQLHQMIAS EIGVPLRDVE MMEGRLSGSD       180
     FSLNATQASD EEGREWIEAL EDESEQAAEL VAHRHDTEQL RDWLIEAMQA LNERERFIVR       240
     ERKLRDEPRT LESLGDELGL SKERVRQLEA AAFAKMRKSL EARSREVQHF LV               292
//

If you have problems or comments...

PBIL Back to PBIL home page