(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSE

CP000031.RPSE        Location/Qualifiers
FT   CDS             500214..500786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SPO0502"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to SP:P02356"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93819"
FT                   /db_xref="GOA:Q5LW41"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW41"
FT                   /protein_id="AAV93819.1"
FT                   /translation="MAERENRRGNRRDREEAAPEFADRLVAINRVSKTVKGGKRFGFAA
FT                   LVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDIEGRHGAGK
FT                   VVMRAAPEGTGIIAGGPMRAVFEMLGVKDVVSKSLGSANPYNMIRATIDGLKKEQSPRS
FT                   VAQRRGKKVADILPKRDEAPAAEAAEA"
     MAERENRRGN RRDREEAAPE FADRLVAINR VSKTVKGGKR FGFAALVVVG DQKGRVGFGK        60
     GKAKEVPEAI RKATEQAKRQ MIRVQLREGR TLHHDIEGRH GAGKVVMRAA PEGTGIIAGG       120
     PMRAVFEMLG VKDVVSKSLG SANPYNMIRA TIDGLKKEQS PRSVAQRRGK KVADILPKRD       180
     EAPAAEAAEA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page