(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSK

CP000031.RPSK        Location/Qualifiers
FT   CDS             507251..507643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SPO0510"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by similarity to SP:P04969"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93827"
FT                   /db_xref="GOA:Q5LW33"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW33"
FT                   /protein_id="AAV93827.1"
FT                   /translation="MARDKTRTTKKKERKNIASGVAHVNSTFNNTKILISDVQGNAISW
FT                   SSAGTMGFKGSRKSTPYAAQLAAEDAGRKAQDHGVKTLEVEVQGPGSGRESALRALAAV
FT                   GFNITSIRDVTPIAHNGCRPPKRRRV"
     MARDKTRTTK KKERKNIASG VAHVNSTFNN TKILISDVQG NAISWSSAGT MGFKGSRKST        60
     PYAAQLAAED AGRKAQDHGV KTLEVEVQGP GSGRESALRA LAAVGFNITS IRDVTPIAHN       120
     GCRPPKRRRV                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page