(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSM

CP000031.RPSM        Location/Qualifiers
FT   CDS             506867..507235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SPO0509"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to SP:P80377"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93826"
FT                   /db_xref="GOA:Q5LW34"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW34"
FT                   /protein_id="AAV93826.1"
FT                   /translation="MARIAGVNIPTAKRVPIALTYITGIGNTSAKAICEAVGIDATRRV
FT                   NELSDAEILAIREHIDANYSVEGDLRREVQMNIKRLMDLGCYRGLRHRRNLPVRGQRTH
FT                   TNARTRKGPAKAIAGKKK"
     MARIAGVNIP TAKRVPIALT YITGIGNTSA KAICEAVGID ATRRVNELSD AEILAIREHI        60
     DANYSVEGDL RREVQMNIKR LMDLGCYRGL RHRRNLPVRG QRTHTNARTR KGPAKAIAGK       120
     KK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page