(data stored in ACNUC7421 zone)

EMBL: CP000031.RPSN

CP000031.RPSN        Location/Qualifiers
FT   CDS             498474..498779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SPO0498"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by similarity to SP:P02370"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93815"
FT                   /db_xref="GOA:Q5LW45"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW45"
FT                   /protein_id="AAV93815.1"
FT                   /translation="MAKKSMIEREKKRERLVAQYAAKRAELKEIANDESRPMEERFKAR
FT                   LKLAKLPRNSSATRLHNRCQLTGRPHAYYRKLKVSRIMLRELGSAGQIPGMVKSSW"
     MAKKSMIERE KKRERLVAQY AAKRAELKEI ANDESRPMEE RFKARLKLAK LPRNSSATRL        60
     HNRCQLTGRP HAYYRKLKVS RIMLRELGSA GQIPGMVKSS W                           101
//

If you have problems or comments...

PBIL Back to PBIL home page