(data stored in ACNUC7421 zone)

EMBL: CP000031.RPST

CP000031.RPST        Location/Qualifiers
FT   CDS             163518..163781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SPO0148"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93476"
FT                   /db_xref="GOA:Q5LWV5"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWV5"
FT                   /protein_id="AAV93476.1"
FT                   /translation="MANSPQAAKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKD
FT                   AATAALRAAQPELMRGVSKGVFHKNTASRKMSRLSSRVKALG"
     MANSPQAAKR ARQNEKRFAI NKARRSRIRT FLRKVEEAIA SGDKDAATAA LRAAQPELMR        60
     GVSKGVFHKN TASRKMSRLS SRVKALG                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page