(data stored in ACNUC7421 zone)

EMBL: CP000031.RTCR

CP000031.RTCR        Location/Qualifiers
FT   CDS             complement(172724..174295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtcR"
FT                   /locus_tag="SPO0156"
FT                   /product="transcriptional regulator RtcR"
FT                   /note="identified by similarity to SP:P38035; match to
FT                   protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93484"
FT                   /db_xref="GOA:Q5LWU7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU7"
FT                   /protein_id="AAV93484.1"
FT                   /translation="MRNVVIGFLGTQLDSGKRKRWKPSVSLCNQPDFPVDRLELLYDQK
FT                   FLRLAENVRREIEVTSPKTEVLLRQLNLSDPWDFQEVYGKLFDLARDYGFDEDRERYFV
FT                   HLTTGTHVAQICWFLLTESRHVPAKLAQTGPPRDEKDGPGKLDIIDLDLSRYNALQQRF
FT                   DLLAREYSDLLKGGIETKSAAYNAVIDRIELVASSSDAPILLLGDSGTGKTELAQRIYE
FT                   LKLQRRRVKGRLVQINCATLRGSSALATLFGQRRSHTGQAGSERSGLLHEASGGVLFLD
FT                   EVDELGLDEQAALLHAIETGRYYPLGSDHEVTSRFQVIAGTSRDPVHLTAEGRFRPDLL
FT                   ARLNMWSFRLPALRDRREDIEANLIFELARAERELGTQVGFNTDARDLFLRFARDPATL
FT                   WPGNFRDFGSAIRRLCTLAPRGRITRAMVEEEIKGLRTGWQRAAGDGDHRLLIGILGNQ
FT                   AAEIDPFDRVQLAEVIRVCRTSASLSEAGRRLFAVSRTQRRTTNDADRLRKYLQRFGLE
FT                   WAMIAE"
     MRNVVIGFLG TQLDSGKRKR WKPSVSLCNQ PDFPVDRLEL LYDQKFLRLA ENVRREIEVT        60
     SPKTEVLLRQ LNLSDPWDFQ EVYGKLFDLA RDYGFDEDRE RYFVHLTTGT HVAQICWFLL       120
     TESRHVPAKL AQTGPPRDEK DGPGKLDIID LDLSRYNALQ QRFDLLAREY SDLLKGGIET       180
     KSAAYNAVID RIELVASSSD APILLLGDSG TGKTELAQRI YELKLQRRRV KGRLVQINCA       240
     TLRGSSALAT LFGQRRSHTG QAGSERSGLL HEASGGVLFL DEVDELGLDE QAALLHAIET       300
     GRYYPLGSDH EVTSRFQVIA GTSRDPVHLT AEGRFRPDLL ARLNMWSFRL PALRDRREDI       360
     EANLIFELAR AERELGTQVG FNTDARDLFL RFARDPATLW PGNFRDFGSA IRRLCTLAPR       420
     GRITRAMVEE EIKGLRTGWQ RAAGDGDHRL LIGILGNQAA EIDPFDRVQL AEVIRVCRTS       480
     ASLSEAGRRL FAVSRTQRRT TNDADRLRKY LQRFGLEWAM IAE                         523
//

If you have problems or comments...

PBIL Back to PBIL home page