(data stored in ACNUC7421 zone)

EMBL: CP000031.SDHB

CP000031.SDHB        Location/Qualifiers
FT   CDS             373340..374119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SPO0361"
FT                   /product="succinate dehydrogenase, iron-sulfur protein"
FT                   /note="identified by match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93679"
FT                   /db_xref="GOA:Q5LXE7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE7"
FT                   /protein_id="AAV93679.1"
FT                   /translation="MVQLTLPKNSRLTTGKTWPKPEGATNLRKFQIYRWNPDDGQNPRV
FT                   DTYFVDMDDCGPMVLDALIYIKNKVDATLTFRRSCREGICGSCAMNIDGINTLACIYGM
FT                   DEIKGDVKIYPLPHMPVVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRRK
FT                   LDGLYECVMCASCSTSCPSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDNLEDPF
FT                   KLYRCHTIMNCAKTCPKGLNPAKAIAEIKKMMVERTV"
     MVQLTLPKNS RLTTGKTWPK PEGATNLRKF QIYRWNPDDG QNPRVDTYFV DMDDCGPMVL        60
     DALIYIKNKV DATLTFRRSC REGICGSCAM NIDGINTLAC IYGMDEIKGD VKIYPLPHMP       120
     VVKDLIPDLT HFYAQHASIM PWLETKTNRP AKEWKQSIED RRKLDGLYEC VMCASCSTSC       180
     PSYWWNGDRY LGPAALLHAY RWIIDSRDEA TGERLDNLED PFKLYRCHTI MNCAKTCPKG       240
     LNPAKAIAEI KKMMVERTV                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page