(data stored in ACNUC7421 zone)

EMBL: CP000031.SDHC

CP000031.SDHC        Location/Qualifiers
FT   CDS             370463..370849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="SPO0358"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="identified by match to protein family HMM PF01127"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93676"
FT                   /db_xref="GOA:Q5LXF0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF0"
FT                   /protein_id="AAV93676.1"
FT                   /translation="MADVNRGNRPLSPHLSIYRPQLTSITSILTRITGNALLFAALLIV
FT                   WWFLAAATSPEYFAVADGVITSLIGDLVMALSLWGLWYHTLAGIRHLIWDNALGLDLPT
FT                   AEKLGWAVVIGSVLLTILTLVVIA"
     MADVNRGNRP LSPHLSIYRP QLTSITSILT RITGNALLFA ALLIVWWFLA AATSPEYFAV        60
     ADGVITSLIG DLVMALSLWG LWYHTLAGIR HLIWDNALGL DLPTAEKLGW AVVIGSVLLT       120
     ILTLVVIA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page