(data stored in ACNUC7421 zone)

EMBL: CP000031.SDHD

CP000031.SDHD        Location/Qualifiers
FT   CDS             370862..371233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="SPO0359"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="identified by similarity to GB:AAC17941.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93677"
FT                   /db_xref="GOA:Q5LXE9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE9"
FT                   /protein_id="AAV93677.1"
FT                   /translation="MRYLTDRKRAVGMGSAKTGTAHFWAMKVSSVALLILIPLFVFTFG
FT                   PMLGEPHQAVLDYFSRPFPAIVAALTLVVGFKHFADGAQVLIEDYVHGLMQKILIILVI
FT                   CLSYAAAATGLFAIARIAL"
     MRYLTDRKRA VGMGSAKTGT AHFWAMKVSS VALLILIPLF VFTFGPMLGE PHQAVLDYFS        60
     RPFPAIVAAL TLVVGFKHFA DGAQVLIEDY VHGLMQKILI ILVICLSYAA AATGLFAIAR       120
     IAL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page