(data stored in ACNUC9435 zone)

EMBL: CP000031.SECA

CP000031.SECA        Location/Qualifiers
FT   CDS             complement(57011..59716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SPO0057"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF02810; match to protein family HMM PF07516;
FT                   match to protein family HMM PF07517; match to protein
FT                   family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93388"
FT                   /db_xref="GOA:Q5LWK0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWK0"
FT                   /protein_id="AAV93388.1"
FT                   /translation="MLGLGTLAKKVFGTPNDRKIKATRPVVAQINALEEEFAKLTDEGL
FT                   KQKTDELRKRALDGESLDALLPEAFANCREAGKRALGLRAFDTQLMGGIFLHQGNISEM
FT                   KTGEGKTLVATFPAYLNALTGKGVHVVTVNEYLAKRDSEWMGKVFAALGMTTGVIWSGQ
FT                   PDAEKMAAYESDITYATNNELGFDYLRDNMKGELSEVYQKQHNFAIVDEVDSILIDEAR
FT                   TPLIISGPAQDRSDLYVAIDALLPALSDDHFELDEKTRNVTFTDEGNEFLEAQLVARGL
FT                   LPEGQSLYDPESTTIVHHVNQGLRAHKLFQRDKDYIVRDGEVVLIDEFTGRMMPGRRLS
FT                   DGLHQAIEAKENAQIQPENVTLASVTFQNYFRLYDKLSGMTGTALTEAEEFAEIYGLGV
FT                   VEVPTNRPIARTDEDDQVYRTAAEKYGAMIDETKKAHEKGQPVLLGTTSIEKSEMLSQM
FT                   LTKEGIEHNVLNARQHEREAQIVAEAGRYGAVTIATNMAGRGTDIQLGGNVEMKVLEAL
FT                   AENPEADPVELRAAEEARHAEEKQKVLDAGGLYVMASERHESRRIDNQLRGRSGRQGDP
FT                   GRTVFYLSLEDDLMRIFGSERLDKVLTTLGMKEGEAIIHPWVNKSLERAQAKVEGRNFD
FT                   MRKNVLKFDDVMNDQRKVIFNQRREIMATEDLSDVVADMREQVIDDLIDEYMPPKTYAD
FT                   QWDTQGLYAAVIEKLGIDVPVIEWAAEEGVDDDEIRERLIKASGDYMESKAADFGAENM
FT                   RNIEKQVLLQTIDSKWREHLLKLEHLRSVVGFRGYAQRDPLNEYKTESFQLFEGLLDSL
FT                   RETVTQQLSRVRMLSEEEQRQMMAQMMAQQNQAEQAAVQAEAVAEAKASGDARPGFVED
FT                   DPSTWGNPARNDLCPCGSGKKFKHCHGRLA"
     MLGLGTLAKK VFGTPNDRKI KATRPVVAQI NALEEEFAKL TDEGLKQKTD ELRKRALDGE        60
     SLDALLPEAF ANCREAGKRA LGLRAFDTQL MGGIFLHQGN ISEMKTGEGK TLVATFPAYL       120
     NALTGKGVHV VTVNEYLAKR DSEWMGKVFA ALGMTTGVIW SGQPDAEKMA AYESDITYAT       180
     NNELGFDYLR DNMKGELSEV YQKQHNFAIV DEVDSILIDE ARTPLIISGP AQDRSDLYVA       240
     IDALLPALSD DHFELDEKTR NVTFTDEGNE FLEAQLVARG LLPEGQSLYD PESTTIVHHV       300
     NQGLRAHKLF QRDKDYIVRD GEVVLIDEFT GRMMPGRRLS DGLHQAIEAK ENAQIQPENV       360
     TLASVTFQNY FRLYDKLSGM TGTALTEAEE FAEIYGLGVV EVPTNRPIAR TDEDDQVYRT       420
     AAEKYGAMID ETKKAHEKGQ PVLLGTTSIE KSEMLSQMLT KEGIEHNVLN ARQHEREAQI       480
     VAEAGRYGAV TIATNMAGRG TDIQLGGNVE MKVLEALAEN PEADPVELRA AEEARHAEEK       540
     QKVLDAGGLY VMASERHESR RIDNQLRGRS GRQGDPGRTV FYLSLEDDLM RIFGSERLDK       600
     VLTTLGMKEG EAIIHPWVNK SLERAQAKVE GRNFDMRKNV LKFDDVMNDQ RKVIFNQRRE       660
     IMATEDLSDV VADMREQVID DLIDEYMPPK TYADQWDTQG LYAAVIEKLG IDVPVIEWAA       720
     EEGVDDDEIR ERLIKASGDY MESKAADFGA ENMRNIEKQV LLQTIDSKWR EHLLKLEHLR       780
     SVVGFRGYAQ RDPLNEYKTE SFQLFEGLLD SLRETVTQQL SRVRMLSEEE QRQMMAQMMA       840
     QQNQAEQAAV QAEAVAEAKA SGDARPGFVE DDPSTWGNPA RNDLCPCGSG KKFKHCHGRL       900
     A                                                                       901
//

If you have problems or comments...

PBIL Back to PBIL home page