(data stored in ACNUC7421 zone)

EMBL: CP000031.SECY

CP000031.SECY        Location/Qualifiers
FT   CDS             503545..504912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SPO0506"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93823"
FT                   /db_xref="GOA:Q5LW37"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW37"
FT                   /protein_id="AAV93823.1"
FT                   /translation="MVSAAEQMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPV
FT                   PGIDGVALREFMEQAGQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTAMVP
FT                   SLEQLKKEGEQGRKKINQYTRLGTVALATVQAYGLAVSLESGDLATEPGMYFRFATMIT
FT                   LVGGTMFLMWLGEQITARGIGNGVSLIIFVGIIAEVPAALAQFFASGRSGAISPAVIIA
FT                   IILMVIAVITFVVFMERALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFAS
FT                   SLLLLPVTISTFSSGAANGPVMSWLLANFGPGQPLYLLFFVSMIVFFAYFYTFNVSFKP
FT                   DDVAQNLKNQNGFVPGIRPGKKTAEYLEYVVNRVLVLGSAYLAAVCLLPEIMRGQFNVP
FT                   FYFGGTSVLIIVSVTMDTIQQVQSHLLAHQYEGLIEKSQLRGKNRKRTNRKGPARR"
     MVSAAEQMAA NTSWSALGKA TDLRNRILFT LGLLIVYRLG TFIPVPGIDG VALREFMEQA        60
     GQGIGGMVSM FTGGALGRMG IFALGIMPYI SASIIVQLLT AMVPSLEQLK KEGEQGRKKI       120
     NQYTRLGTVA LATVQAYGLA VSLESGDLAT EPGMYFRFAT MITLVGGTMF LMWLGEQITA       180
     RGIGNGVSLI IFVGIIAEVP AALAQFFASG RSGAISPAVI IAIILMVIAV ITFVVFMERA       240
     LRKIHIQYPR RQVGMKVYDG GSSHLPVKVN PAGVIPAIFA SSLLLLPVTI STFSSGAANG       300
     PVMSWLLANF GPGQPLYLLF FVSMIVFFAY FYTFNVSFKP DDVAQNLKNQ NGFVPGIRPG       360
     KKTAEYLEYV VNRVLVLGSA YLAAVCLLPE IMRGQFNVPF YFGGTSVLII VSVTMDTIQQ       420
     VQSHLLAHQY EGLIEKSQLR GKNRKRTNRK GPARR                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page