(data stored in ACNUC9435 zone)

EMBL: CP000031.SOXR

CP000031.SOXR        Location/Qualifiers
FT   CDS             325911..326366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxR"
FT                   /locus_tag="SPO0314"
FT                   /product="redox-sensitive transcriptional activator SoxR"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM TIGR01950"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93632"
FT                   /db_xref="GOA:Q5LXA2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA2"
FT                   /protein_id="AAV93632.1"
FT                   /translation="MPASEGLSIGALARRTGLAVSAIRYYETQGLIAPWRNAGGQRRYQ
FT                   RADLRRLSFVMIAQQLGLTLPEIREVLAGLPGNRTPTRGDWTRISTALRERLNQRIATL
FT                   ERLRDNLDGCIGCGCLSLPNCALYNPADRVGSKGPGPRLVLDETGDL"
     MPASEGLSIG ALARRTGLAV SAIRYYETQG LIAPWRNAGG QRRYQRADLR RLSFVMIAQQ        60
     LGLTLPEIRE VLAGLPGNRT PTRGDWTRIS TALRERLNQR IATLERLRDN LDGCIGCGCL       120
     SLPNCALYNP ADRVGSKGPG PRLVLDETGD L                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page