(data stored in ACNUC9435 zone)

EMBL: CP000031.SUCB

CP000031.SUCB        Location/Qualifiers
FT   CDS             complement(353635..355143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="SPO0343"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817; match to protein family HMM TIGR01347"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93661"
FT                   /db_xref="GOA:Q5LXC8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC8"
FT                   /protein_id="AAV93661.2"
FT                   /translation="MTIEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVT
FT                   VEVPAPAAGVMGDIVAKEGETVGVNALLATITAGEGAAAAPAAPAAAAPAASSGGSVDV
FT                   MVPTLGESVTEATVSTWFKKVGDSVAQDEMLCELETDKVSVEVPAPASGVLTEIVAAEG
FT                   ATVNASAKLAVISGSASGASPAPAAPAAAVTPAVATGKDIANAPSAEKAMAEAGITPAQ
FT                   VTGTGRDGRIMKEDVTAAVAAAAAAPAPAAAAPAPAAAPRAPALAEDAAREERVRMTRL
FT                   RQTIARRLKDAQNTAAILTTYNEVDMTEVMALRNTYKDAFEKKHGVRMGFMSFFTKACC
FT                   HALKEVPEVNAEIDGQDIVYKNYVHMGVAAGTPQGLVVPVIRDADQMSFAEIEKAIAEK
FT                   GKRARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPMVINGE
FT                   IKIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL"
     MTIEVRVPTL GESVTEATVA TWFKKPGDAV AVDEMLCELE TDKVTVEVPA PAAGVMGDIV        60
     AKEGETVGVN ALLATITAGE GAAAAPAAPA AAAPAASSGG SVDVMVPTLG ESVTEATVST       120
     WFKKVGDSVA QDEMLCELET DKVSVEVPAP ASGVLTEIVA AEGATVNASA KLAVISGSAS       180
     GASPAPAAPA AAVTPAVATG KDIANAPSAE KAMAEAGITP AQVTGTGRDG RIMKEDVTAA       240
     VAAAAAAPAP AAAAPAPAAA PRAPALAEDA AREERVRMTR LRQTIARRLK DAQNTAAILT       300
     TYNEVDMTEV MALRNTYKDA FEKKHGVRMG FMSFFTKACC HALKEVPEVN AEIDGQDIVY       360
     KNYVHMGVAA GTPQGLVVPV IRDADQMSFA EIEKAIAEKG KRARDGKLSM AEMQGGTFTI       420
     SNGGVYGSLM SSPILNPPQS GILGMHKIQD RPMVINGEIK IRPMMYLALS YDHRIVDGKG       480
     AVTFLVRVKE ALEDPRRLLM DL                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page