(data stored in ACNUC9435 zone)

EMBL: CP000031.SUCD

CP000031.SUCD        Location/Qualifiers
FT   CDS             complement(359481..360365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="SPO0346"
FT                   /product="succinyl-CoA synthase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by similarity to SP:P07459; match to
FT                   protein family HMM PF00549; match to protein family HMM
FT                   PF02629; match to protein family HMM TIGR01019"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93664"
FT                   /db_xref="GOA:Q5LXC5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC5"
FT                   /protein_id="AAV93664.1"
FT                   /translation="MAVLIDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   MEHLGLPVFNSVHEAKHVTEANATVIYVPPPFAADSILEAIDAQMEVIVCITEGIPVLD
FT                   MMKVKRALEGSSSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVK
FT                   QTSDIGLGQSTAVGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFL
FT                   KDEAKKGRKKPVAGFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRSAGIVVADSP
FT                   ATLGEAVLEAIGK"
     MAVLIDENTK VICQGFTGSQ GTFHSEQAIA YGTKMVGGVT PGKGGMEHLG LPVFNSVHEA        60
     KHVTEANATV IYVPPPFAAD SILEAIDAQM EVIVCITEGI PVLDMMKVKR ALEGSSSRLI       120
     GPNCPGVITP DACKIGIMPG HIHKRGSVGV VSRSGTLTYE AVKQTSDIGL GQSTAVGIGG       180
     DPIKGTEHID VLEWFLADDE TESIIMIGEI GGSAEEEAAQ FLKDEAKKGR KKPVAGFIAG       240
     RTAPPGRRMG HAGAIVAGGK GGAEDKIEAM RSAGIVVADS PATLGEAVLE AIGK             294
//

If you have problems or comments...

PBIL Back to PBIL home page